Structure of PDB 8ev3 Chain i

Receptor sequence
>8ev3i (length=98) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
APGLVVGLNKGKTLTKRQLPERPSRRKGHLSKRTAFVRSIVREVAGFAPY
ERRVMELIRNSQDKRARKLAKKRLGTLKRAKGKIEELTSVIQSSRLAH
3D structure
PDB8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Chaini
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i K13 L15 R23 P24 S25 R26 R27 K28 G29 H30 L31 S32 R34 Y51 R74 L75 K79 R80 K12 L14 R22 P23 S24 R25 R26 K27 G28 H29 L30 S31 R33 Y50 R73 L74 K78 R79
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
PDBsum8ev3
PubMed36423630
UniProtO94658|RL36B_SCHPO Large ribosomal subunit protein eL36B (Gene Name=rpl3602)

[Back to BioLiP]