Structure of PDB 8eui Chain i

Receptor sequence

>8euii (length=96) Species: 4896 (Schizosaccharomyces pombe)

APGLVVGLNKGKTLTKRQLPERPSRRKGHLSKRTAFVRSIVREVAGFAPY
ERRVMELIRNSQDKRARKLAKKRLGTLKRAKGKIEELTSVIQSSRL

3D structure

• PDB: 8eui Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: i
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	K11 G12 K13 L15 R23 P24 S25 R26 R27 K28 G29 H30 L31 S32 K33 R34 T35 R39 Y51 R66 K73 R74 L75 L78 R80 K82 K84	K10 G11 K12 L14 R22 P23 S24 R25 R26 K27 G28 H29 L30 S31 K32 R33 T34 R38 Y50 R65 K72 R73 L74 L77 R79 K81 K83

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8eui, PDBe:8eui, PDBj:8eui
• PDBsum: 8eui
• PubMed: 36423630
• UniProt: O94658|RL36B_SCHPO Large ribosomal subunit protein eL36B (Gene Name=rpl3602)