Structure of PDB 7uvx Chain i

Receptor sequence

>7uvxi (length=126) Species: 480119 (Acinetobacter baumannii AB0057)

TNYGTGRRKTATARVFLSAGTGKLVINNRTLEQYFGRETARMVVRQPLEL
LEATEKYDLYITVKGGGIGGQAGAIRHGITRALIAADETLKPVLRQAGFV
TRDAREVERKKLGLRKARKRPQFSKR

3D structure

• PDB: 7uvx Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
• Chain: i
• Resolution: 2.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	Y5 R9 R10 K11 T14 R16 F18 R31 G67 G68 G69 G71 R83 K93 R97 R104 R107 E108 E110 R111 K112 K113 L114 G115 R117 K118 R120 K121 R122 Q124 F125	Y3 R7 R8 K9 T12 R14 F16 R29 G65 G66 G67 G69 R81 K91 R95 R102 R105 E106 E108 R109 K110 K111 L112 G113 R115 K116 R118 K119 R120 Q122 F123

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7uvx, PDBe:7uvx, PDBj:7uvx
• PDBsum: 7uvx
• PubMed: 37192172
• UniProt: V5VBA5