Structure of PDB 7unv Chain i

Receptor sequence

>7unvi (length=127) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]

TQNYGTGRRKTATARVFLRPGTGKISINNRGLDQFFGRETARMVVRQPLE
LTETVEKFDIFVTVVGGGVSGQAGAIRHGITRALIEYDETLRSSLRKAGY
VTRDAREVERKKVGLRKARKRPQYSKR

3D structure

PDB

7unv Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	Y7 R11 K13 T14 T16 R18 F20 R22 R33 R41 G69 G70 G71 S73 Q75 R85 R95 R99 T105 R106 R109 E110 V111 E112 R113 K114 K115 K120 R122 R124 Q126 Y127 K129	Y4 R8 K10 T11 T13 R15 F17 R19 R30 R38 G66 G67 G68 S70 Q72 R82 R92 R96 T102 R103 R106 E107 V108 E109 R110 K111 K112 K117 R119 R121 Q123 Y124 K126
BS02	rna	i	K129 R130	K126 R127

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7unv, PDBe:7unv, PDBj:7unv
PDBsum	7unv
PubMed
UniProt	Q9HVY3\|RS9_PSEAE Small ribosomal subunit protein uS9 (Gene Name=rpsI)