Structure of PDB 7ug6 Chain i

Receptor sequence
>7ug6i (length=99) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLS
PYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH
3D structure
PDB7ug6 A single 2'-O-methylation of ribosomal RNA gates assembly of a functional ribosome.
Chaini
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i G14 K15 I26 S27 Y28 K29 K30 G31 A33 S34 R36 R41 Y53 N63 R68 K71 K74 R76 L77 G78 R82 K86 G13 K14 I25 S26 Y27 K28 K29 G30 A32 S33 R35 R40 Y52 N62 R67 K70 K73 R75 L76 G77 R81 K85
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ug6, PDBe:7ug6, PDBj:7ug6
PDBsum7ug6
PubMed36536102
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]