Structure of PDB 7qws Chain i

Receptor sequence

>7qwsi (length=102) Species: 9986 (Oryctolagus cuniculus)

ALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFA
PYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSSVLAAMRKAA
AK

3D structure

• PDB: 7qws Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
• Chain: i
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	R4 G14 H15 R25 H26 S27 R28 R29 R30 G31 L33 T34 H36 R41 Y53 R56 K67 R68 K71 K75 R76 H80 R82 R85 K86 E89	R3 G13 H14 R24 H25 S26 R27 R28 R29 G30 L32 T33 H35 R40 Y52 R55 K66 R67 K70 K74 R75 H79 R81 R84 K85 E88

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qws, PDBe:7qws, PDBj:7qws
• PDBsum: 7qws
• PubMed: 35201867
• UniProt: G1TTQ5|RL36_RABIT Large ribosomal subunit protein eL36 (Gene Name=RPL36)