Structure of PDB 7qi6 Chain i

Receptor sequence

>7qi6i (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]

IGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLR
GWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR

3D structure

PDB

7qi6 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.

Chain

Resolution

2.98 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	I32 G33 I34 R35 L36 K42 R46 K50 R51 F66 K68 H69 P70 E72 R75 W79 R93 K94 R95 K96 S100 K112 R113 R115 Y116 Y118 H120 F121 R123 H124 G125 K126 F127	I1 G2 I3 R4 L5 K11 R15 K19 R20 F35 K37 H38 P39 E41 R44 W48 R62 K63 R64 K65 S69 K81 R82 R84 Y85 Y87 H89 F90 R92 H93 G94 K95 F96

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7qi6, PDBe:7qi6, PDBj:7qi6
PDBsum	7qi6
PubMed	38769321
UniProt	Q4U2R6\|RM51_HUMAN Large ribosomal subunit protein mL51 (Gene Name=MRPL51)