Structure of PDB 7qh7 Chain i

Receptor sequence
>7qh7i (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]
IGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLR
GWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR
3D structure
PDB7qh7 A late-stage assembly checkpoint of the human mitochondrial ribosome large subunit.
Chaini
Resolution2.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i I32 R35 K42 R46 R51 G61 F66 K68 H69 P70 I78 W79 R93 K94 H108 K112 R113 R115 Y116 Y118 K119 H120 F121 K126 F127 I1 R4 K11 R15 R20 G30 F35 K37 H38 P39 I47 W48 R62 K63 H77 K81 R82 R84 Y85 Y87 K88 H89 F90 K95 F96
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome

View graph for
Molecular Function
External links
PDB RCSB:7qh7, PDBe:7qh7, PDBj:7qh7
PDBsum7qh7
PubMed35177605
UniProtQ4U2R6|RM51_HUMAN Large ribosomal subunit protein mL51 (Gene Name=MRPL51)

[Back to BioLiP]