Structure of PDB 7pkt Chain i

Receptor sequence

>7pkti (length=152) Species: 3055 (Chlamydomonas reinhardtii)

EAIKHLKDLQHIKLEGLRFRIIDAKGQVVGRLAEQISVILQGKDKPTYNP
TKEQGDVVIVVNASHVELTHDKWNTKLYRWHTGYPGGLRSRPAGDQWEKD
PRMLLRNAVSGMLPKNKSREARMEKLKIFPEADHPFQGFPLVPYVPPPRR
LQ

3D structure

• PDB: 7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.
• Chain: i
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	N54 P55 T56 N121 K122 S123	N49 P50 T51 N116 K117 S118
BS02	rna	i	E39 Q46 K48 M117 P119	E34 Q41 K43 M112 P114
BS03	rna	i	V33 G35 R36 T74 H75 K77 K81 R84 H86 G91 A113 G116	V28 G30 R31 T69 H70 K72 K76 R79 H81 G86 A108 G111
BS04	rna	i	K120 R124	K115 R119
BS05	rna	i	K12 W85 T87 Y89 P90 R94 K104	K7 W80 T82 Y84 P85 R89 K99

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pkt, PDBe:7pkt, PDBj:7pkt
• PDBsum: 7pkt
• PubMed: 34887394
• UniProt: A8J810