Structure of PDB 7pjx Chain i

Receptor sequence

>7pjxi (length=127) Species: 562 (Escherichia coli) [Search protein sequence]

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

PDB

7pjx Structural mechanism of GTPase-powered ribosome-tRNA movement.

Chain

Resolution

6.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	Q4 Y6 T8 R10 R11 K12 S13 R17 F19 Y37 Y63 K67 G68 G69 G70 S72 G73 Q74 R84 R94 R98 V103 T104 R105 A107 R108 Q109 V110 E111 R112 K113 K114 V115 G116 R118 K119 R121 R122 R123 P124 Q125 F126 S127 K128 R129	Q2 Y4 T6 R8 R9 K10 S11 R15 F17 Y35 Y61 K65 G66 G67 G68 S70 G71 Q72 R82 R92 R96 V101 T102 R103 A105 R106 Q107 V108 E109 R110 K111 K112 V113 G114 R116 K117 R119 R120 R121 P122 Q123 F124 S125 K126 R127
BS02	rna	i	K128 R129	K126 R127

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links