Structure of PDB 7pir Chain i

Receptor sequence

>7piri (length=144) Species: 272634 (Mycoplasmoides pneumoniae M129)

KTSMLTKEQANKRRQWYIVDAAGLVLGKLAVKAADLIRGKNKVDFTPNQD
CGDYLIIINSDQVVLTGNKKENEFWYHHSQYIGGIKKVSGRDMLKKQSDK
LVYNAVKGMLPDNRLSRRWITKVHVFKGDKHNMEAQKPTTLNWS

3D structure

• PDB: 7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: i
• Resolution: 12.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	K3 T4 S5 K9 Q11 A12 V27 L28 G29 K30 V33 R40 P49 N50 Q51 T68 G69 N70 K71 N74 E75 W77 Y78 H79 H80 Q82 Y83 I84 G85 I87 R93 Q99 N106 A107 G110 M111 L112 P113 N115 R116 L117 R119 R120 I122 Q138	K1 T2 S3 K7 Q9 A10 V25 L26 G27 K28 V31 R38 P47 N48 Q49 T66 G67 N68 K69 N72 E73 W75 Y76 H77 H78 Q80 Y81 I82 G83 I85 R91 Q97 N104 A105 G108 M109 L110 P111 N113 R114 L115 R117 R118 I120 Q136

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pir, PDBe:7pir, PDBj:7pir
• PDBsum: 7pir
• PubMed: 36171285
• UniProt: P75178|RL13_MYCPN Large ribosomal subunit protein uL13 (Gene Name=rplM)