Structure of PDB 7pib Chain i

Receptor sequence

>7pibi (length=144) Species: 272634 (Mycoplasmoides pneumoniae M129)

KTSMLTKEQANKRRQWYIVDAAGLVLGKLAVKAADLIRGKNKVDFTPNQD
CGDYLIIINSDQVVLTGNKKENEFWYHHSQYIGGIKKVSGRDMLKKQSDK
LVYNAVKGMLPDNRLSRRWITKVHVFKGDKHNMEAQKPTTLNWS

3D structure

• PDB: 7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: i
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	S5 K9 Q11 K14 L28 G29 K30 V33 K42 P49 N50 Q51 Y56 T68 K71 W77 Y78 H80 S81 Y83 I87 K88 A107 M111 L112 P113 D114 N115 R116 T123	S3 K7 Q9 K12 L26 G27 K28 V31 K40 P47 N48 Q49 Y54 T66 K69 W75 Y76 H78 S79 Y81 I85 K86 A105 M109 L110 P111 D112 N113 R114 T121

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pib, PDBe:7pib, PDBj:7pib
• PDBsum: 7pib
• PubMed: 36171285
• UniProt: P75178|RL13_MYCPN Large ribosomal subunit protein uL13 (Gene Name=rplM)