Structure of PDB 7oyd Chain i

Receptor sequence

>7oydi (length=101) Species: 9986 (Oryctolagus cuniculus)

ALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFA
PYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSSVLAAMRKAA
A

3D structure

• PDB: 7oyd A molecular network of conserved factors keeps ribosomes dormant in the egg.
• Chain: i
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	R4 G14 H15 V17 R25 H26 S27 R28 R29 R30 G31 R32 L33 H36 R41 Y53 K67 R68 K74 K75 R76 G78 T79 H80 R82 K84 R85 K86	R3 G13 H14 V16 R24 H25 S26 R27 R28 R29 G30 R31 L32 H35 R40 Y52 K66 R67 K73 K74 R75 G77 T78 H79 R81 K83 R84 K85

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oyd, PDBe:7oyd, PDBj:7oyd
• PDBsum: 7oyd
• PubMed: 36653451
• UniProt: G1TTQ5|RL36_RABIT Large ribosomal subunit protein eL36 (Gene Name=RPL36)