Structure of PDB 7oui Chain i

Receptor sequence
>7ouii (length=35) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGRE
3D structure
PDB7oui High-resolution model of Arabidopsis Photosystem II reveals the structural consequences of digitonin-extraction.
Chaini
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA i Y9 V11 V12 F15 Y9 V11 V12 F15
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oui, PDBe:7oui, PDBj:7oui
PDBsum7oui
PubMed34330992
UniProtP62100|PSBI_ARATH Photosystem II reaction center protein I (Gene Name=psbI)

[Back to BioLiP]