Structure of PDB 7nac Chain i

Receptor sequence
>7naci (length=79) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
TSMTPAYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARK
VAKKRLGSFTRAKAKVEEMNNIIAASRRH
3D structure
PDB7nac Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Chaini
Resolution3.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i Y28 K29 K30 A33 R36 R41 Y53 R76 L77 R82 Y7 K8 K9 A12 R15 R20 Y32 R55 L56 R61
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nac, PDBe:7nac, PDBj:7nac
PDBsum7nac
PubMed36482249
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]