Structure of PDB 7n8o Chain i

Receptor sequence
>7n8oi (length=36) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]
MLTLKIAVYIVVGLFISLFIFGFLSSDPTRNPGRKD
3D structure
PDB7n8o High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
Chaini
Resolution1.93 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA i V8 Y9 V12 F15 V8 Y9 V12 F15
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030096 plasma membrane-derived thylakoid photosystem II
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7n8o, PDBe:7n8o, PDBj:7n8o
PDBsum7n8o
PubMed34937700
UniProtQ54697|PSBI_SYNY3 Photosystem II reaction center protein I (Gene Name=psbI)

[Back to BioLiP]