Structure of PDB 7mdz Chain i

Receptor sequence

>7mdzi (length=102) Species: 9986 (Oryctolagus cuniculus)

ALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFA
PYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSSVLAAMRKAA
AK

3D structure

• PDB: 7mdz Discovery of C13-Aminobenzoyl Cycloheximide Derivatives that Potently Inhibit Translation Elongation.
• Chain: i
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	G14 H15 R25 H26 S27 R28 R29 R30 G31 R32 L33 T34 R41 Y53 K67 R68 K75 R76 G78 H80 I81 R82 K84 R85	G13 H14 R24 H25 S26 R27 R28 R29 G30 R31 L32 T33 R40 Y52 K66 R67 K74 R75 G77 H79 I80 R81 K83 R84

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7mdz, PDBe:7mdz, PDBj:7mdz
• PDBsum: 7mdz
• PubMed: 34403584
• UniProt: G1TTQ5|RL36_RABIT Large ribosomal subunit protein eL36 (Gene Name=RPL36)