Structure of PDB 7m4y Chain i

Receptor sequence

>7m4yi (length=126) Species: 480119 (Acinetobacter baumannii AB0057)

TNYGTGRRKTATARVFLSAGTGKLVINNRTLEQYFGRETARMVVRQPLEL
LEATEKYDLYITVKGGGIGGQAGAIRHGITRALIAADETLKPVLRQAGFV
TRDAREVERKKLGLRKARKRPQFSKR

3D structure

• PDB: 7m4y Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
• Chain: i
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	Y5 R9 R10 K11 T14 R16 F18 R31 R39 Y62 G67 G68 G69 I70 G71 Q73 R83 K93 R97 R104 R107 E108 E110 R111 K112 K113 G115 R117 K118 R120 K121 R122 Q124 F125	Y3 R7 R8 K9 T12 R14 F16 R29 R37 Y60 G65 G66 G67 I68 G69 Q71 R81 K91 R95 R102 R105 E106 E108 R109 K110 K111 G113 R115 K116 R118 K119 R120 Q122 F123
BS02	rna	i	K127 R128	K125 R126

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7m4y, PDBe:7m4y, PDBj:7m4y
• PDBsum: 7m4y
• PubMed: 34044590
• UniProt: V5VBA5