Structure of PDB 7l08 Chain i

Receptor sequence

>7l08i (length=97) Species: 9606 (Homo sapiens)

IGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLR
GWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR

3D structure

• PDB: 7l08 Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
• Chain: i
• Resolution: 3.49 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	I32 L36 R46 R51 F66 K68 H69 P70 R75 G76 I78 N86 R93 R95 M97 L107 K112 R113 R115 Y116 Y118 H120 F121 R123 H124 G125 K126 F127	I1 L5 R15 R20 F35 K37 H38 P39 R44 G45 I47 N55 R62 R64 M66 L76 K81 R82 R84 Y85 Y87 H89 F90 R92 H93 G94 K95 F96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7l08, PDBe:7l08, PDBj:7l08
• PDBsum: 7l08
• PubMed: 34127662
• UniProt: Q4U2R6|RM51_HUMAN Large ribosomal subunit protein mL51 (Gene Name=MRPL51)