Structure of PDB 7btb Chain i

Receptor sequence

>7btbi (length=99) Species: 559292 (Saccharomyces cerevisiae S288C)

TVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLS
PYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH

3D structure

• PDB: 7btb Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
• Chain: i
• Resolution: 3.22 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	K15 I26 S27 Y28 K29 K30 G31 A33 S34 R41 K67 R68 R76 R82	K14 I25 S26 Y27 K28 K29 G30 A32 S33 R40 K66 R67 R75 R81

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7btb, PDBe:7btb, PDBj:7btb
• PDBsum: 7btb
• PubMed: 33037216
• UniProt: P05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)