Structure of PDB 7as8 Chain i

Receptor sequence

>7as8i (length=64) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

PKMKTHRGSAKRFKKTGSGKLKRSHAYTSHLFANKSQKQKRKLRKSAVVS
AGDFKRIKQMLANI

3D structure

• PDB: 7as8 Structural Basis for Bacterial Ribosome-Associated Quality Control by RqcH and RqcP.
• Chain: i
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	P2 K3 M4 K5 T6 H7 R8 K12 R13 T17 S19 K23 R24 H26 A27 Y28 S30 H31 L32 F33 A34 N35 Q38 K39 Q40 K41 R42 K43 R45 K46 D54 K56 R57 Q60 N64	P1 K2 M3 K4 T5 H6 R7 K11 R12 T16 S18 K22 R23 H25 A26 Y27 S29 H30 L31 F32 A33 N34 Q37 K38 Q39 K40 R41 K42 R44 K45 D53 K55 R56 Q59 N63

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7as8, PDBe:7as8, PDBj:7as8
• PDBsum: 7as8
• PubMed: 33259810
• UniProt: P55874|RL35_BACSU Large ribosomal subunit protein bL35 (Gene Name=rpmI)