Structure of PDB 7aqd Chain i

Receptor sequence
>7aqdi (length=65) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIREVRKAI
ARMKTVIREREIAAN
3D structure
PDB7aqd Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
Chaini
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i K2 T40 A41 R47 K48 A51 R52 K54 T55 R58 E59 I62 K2 T40 A41 R47 K48 A51 R52 K54 T55 R58 E59 I62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aqd, PDBe:7aqd, PDBj:7aqd
PDBsum7aqd
PubMed33259811
UniProtP12873|RL29_BACSU Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]