Structure of PDB 6ylg Chain i

Receptor sequence

>6ylgi (length=96) Species: 4932 (Saccharomyces cerevisiae)

VKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSP
YERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASR

3D structure

• PDB: 6ylg Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
• Chain: i
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	G14 K15 V17 K25 I26 S27 Y28 K30 G31 A33 S34 R36 R41 Y53 K67 R68 K75 R76 G78 R82 K84	G12 K13 V15 K23 I24 S25 Y26 K28 G29 A31 S32 R34 R39 Y51 K65 R66 K73 R74 G76 R80 K82

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ylg, PDBe:6ylg, PDBj:6ylg
• PDBsum: 6ylg
• PubMed: 32668200
• UniProt: P05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)