Structure of PDB 6vlz Chain i

Receptor sequence

>6vlzi (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]

IGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLR
GWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR

3D structure

PDB

6vlz Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.

Chain

Resolution

2.97 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	I32 L36 R46 R51 G61 F66 H69 P70 R75 G76 P77 I78 W79 N86 E87 R93 R95 K96 M97 G99 L107 R113 R115 Y116 Y118 K119 H120 F121 R123 K126 F127	I1 L5 R15 R20 G30 F35 H38 P39 R44 G45 P46 I47 W48 N55 E56 R62 R64 K65 M66 G68 L76 R82 R84 Y85 Y87 K88 H89 F90 R92 K95 F96

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6vlz, PDBe:6vlz, PDBj:6vlz
PDBsum	6vlz
PubMed	32737313
UniProt	Q4U2R6\|RM51_HUMAN Large ribosomal subunit protein mL51 (Gene Name=MRPL51)