Structure of PDB 6v3b Chain i

Receptor sequence

>6v3bi (length=127) Species: 470 (Acinetobacter baumannii)

ATNYGTGRRKTATARVFLSAGTGKLVINNRTLEQYFGRETARMVVRQPLE
LLEATEKYDLYITVKGGGIGGQAGAIRHGITRALIAADETLKPVLRQAGF
VTRDAREVERKKLGLRKARKRPQFSKR

3D structure

• PDB: 6v3b Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.
• Chain: i
• Resolution: 2.91 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	Y5 R9 R10 K11 T12 T14 R16 F18 G67 G68 G69 G71 Q73 R83 K93 R97 T103 R104 R107 E108 E110 R111 K112 K113 G115 R117 K118 R120 K121 R122 Q124 F125 S126	Y4 R8 R9 K10 T11 T13 R15 F17 G66 G67 G68 G70 Q72 R82 K92 R96 T102 R103 R106 E107 E109 R110 K111 K112 G114 R116 K117 R119 K120 R121 Q123 F124 S125

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6v3b, PDBe:6v3b, PDBj:6v3b
• PDBsum: 6v3b
• PubMed: 31964740
• UniProt: V5VBA5