Structure of PDB 6uzv Chain i

Receptor sequence
>6uzvi (length=37) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]
MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESE
3D structure
PDB6uzv The structure of a red-shifted photosystem I reveals a red site in the core antenna.
Chaini
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA i A24 V25 A24 V25
BS02 CLA i W12 W20 L21 W12 W20 L21
BS03 CLA i P11 L14 I15 V18 P11 L14 I15 V18
BS04 CLA i G19 W20 G19 W20
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uzv, PDBe:6uzv, PDBj:6uzv
PDBsum6uzv
PubMed33077842
UniProtQ55330|PSAI_SYNY3 Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]