Structure of PDB 6swa Chain i

Receptor sequence
>6swai (length=69) Species: 10090 (Mus musculus) [Search protein sequence]
PRKIEEIKDFLLTARRKDAKSVKIKKNKDNVKFKVRCSRYLYTLVITDKE
KAEKLKQSLPPGLAVKDLK
3D structure
PDB6swa Protein Synthesis in the Developing Neocortex at Near-Atomic Resolution Reveals Ebp1-Mediated Neuronal Proteostasis at the 60S Tunnel Exit.
Chaini
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i P2 K4 D19 K26 K33 K35 R37 S39 R40 Y41 L42 T44 L69 P1 K3 D18 K25 K32 K34 R36 S38 R39 Y40 L41 T43 L68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0001501 skeletal system development
GO:0001503 ossification
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0007605 sensory perception of sound
GO:0034463 90S preribosome assembly
GO:0042474 middle ear morphogenesis
GO:0048318 axial mesoderm development
GO:0140236 translation at presynapse
GO:0140242 translation at postsynapse
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0033291 eukaryotic 80S initiation complex
GO:0045202 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6swa, PDBe:6swa, PDBj:6swa
PDBsum6swa
PubMed33357414
UniProtQ9JJI8|RL38_MOUSE Large ribosomal subunit protein eL38 (Gene Name=Rpl38)

[Back to BioLiP]