Structure of PDB 6o8z Chain i

Receptor sequence

>6o8zi (length=128) Species: 1351 (Enterococcus faecalis)

QVQYSGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLREVINQPF
GVTETKGAYDVIVNVNGGGYAGQSGAIRHGIARALLQVDPDFRSALKRAG
LLTRDARMVERKKPGLKKARKASQFSKR

3D structure

• PDB: 6o8z Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
• Chain: i
• Resolution: 3.49 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	R11 R12 K13 R18 R20 P40 H41 N68 G69 G70 G71 Y72 A73 G74 R95 R100 T105 R106 R109 M110 E112 K114 K115 P116 K119 K120 R122 K123 A124 Q126	R9 R10 K11 R16 R18 P38 H39 N66 G67 G68 G69 Y70 A71 G72 R93 R98 T103 R104 R107 M108 E110 K112 K113 P114 K117 K118 R120 K121 A122 Q124

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6o8z, PDBe:6o8z, PDBj:6o8z
• PDBsum: 6o8z
• PubMed: 33004869
• UniProt: A0A1B4XSA2