Structure of PDB 6nu2 Chain i

Receptor sequence
>6nu2i (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]
IGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLR
GWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR
3D structure
PDB6nu2 Structural insights into unique features of the human mitochondrial ribosome recycling.
Chaini
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i I32 G33 L36 R46 K50 R51 G61 H69 P70 R75 P77 N86 R93 H108 K112 R113 R115 Y116 Y118 H120 F121 R123 H124 K126 F127 I1 G2 L5 R15 K19 R20 G30 H38 P39 R44 P46 N55 R62 H77 K81 R82 R84 Y85 Y87 H89 F90 R92 H93 K95 F96
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome

View graph for
Molecular Function
External links
PDB RCSB:6nu2, PDBe:6nu2, PDBj:6nu2
PDBsum6nu2
PubMed30962385
UniProtQ4U2R6|RM51_HUMAN Large ribosomal subunit protein mL51 (Gene Name=MRPL51)

[Back to BioLiP]