Structure of PDB 6n8j Chain i

Receptor sequence

>6n8ji (length=96) Species: 559292 (Saccharomyces cerevisiae S288C)

VKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSP
YERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASR

3D structure

• PDB: 6n8j Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
• Chain: i
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	K13 G14 K15 V17 K25 I26 S27 Y28 K29 K30 G31 A33 S34 N35 R41 Y53 R55 R62 R68 K75 R76 G78 R82 K84 K86 R98	K11 G12 K13 V15 K23 I24 S25 Y26 K27 K28 G29 A31 S32 N33 R39 Y51 R53 R60 R66 K73 R74 G76 R80 K82 K84 R96

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n8j, PDBe:6n8j, PDBj:6n8j
• PDBsum: 6n8j
• PubMed: 30814529
• UniProt: P05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)