Structure of PDB 6fyy Chain i

Receptor sequence
>6fyyi (length=121) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
GKKNTKGGKKGRRGKNDSDGPKRELIYKEEGQEYAQITKMLGNGRVEASC
FDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEAR
TLKNQGELPENAKINETDNFG
3D structure
PDB6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
Chaini
Resolution3.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna i G2 K4 N5 G9 K10 K11 R13 R14 G15 K16 N17 K23 L42 G43 N44 G45 R46 M58 I61 R62 G63 K64 R66 K67 V69 W70 M71 G1 K3 N4 G8 K9 K10 R12 R13 G14 K15 N16 K22 L41 G42 N43 G44 R45 M57 I60 R61 G62 K63 R65 K66 V68 W69 M70
BS02 rna i K7 K11 K67 W70 K6 K10 K66 W69
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0019901 protein kinase binding
GO:0031369 translation initiation factor binding
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0001677 formation of translation initiation ternary complex
GO:0001731 formation of translation preinitiation complex
GO:0001732 formation of cytoplasmic translation initiation complex
GO:0002188 translation reinitiation
GO:0006412 translation
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0010494 cytoplasmic stress granule
GO:0016282 eukaryotic 43S preinitiation complex
GO:0033290 eukaryotic 48S preinitiation complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6fyy, PDBe:6fyy, PDBj:6fyy
PDBsum6fyy
PubMed30475211
UniProtP38912|IF1A_YEAST Eukaryotic translation initiation factor 1A (Gene Name=TIF11)

[Back to BioLiP]