Structure of PDB 6cb1 Chain i

Receptor sequence
>6cb1i (length=84) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
VTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGE
KRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH
3D structure
PDB6cb1 Modular assembly of the nucleolar pre-60S ribosomal subunit.
Chaini
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i S27 Y28 K29 K30 G31 A32 A33 R76 G78 S11 Y12 K13 K14 G15 A16 A17 R60 G62
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6cb1, PDBe:6cb1, PDBj:6cb1
PDBsum6cb1
PubMed29512650
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]