Structure of PDB 5nco Chain i

Receptor sequence

>5ncoi (length=450) Species: 562 (Escherichia coli) [Search protein sequence]

NLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFIN
RVKEKAVGHEVNKSLTPGQEFVKIVRNELVAAMGEENQTLNLAAQPPAVV
LMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAE
QVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMD
EIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGD
ARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDVLSL
IEDIESKVDRAQAEKLASKLKKGDGFDLNDFLEQLRQMKNMGGPPPPPPP
PPPPPPPPPPPPPPPDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIA
AGCGMQVQDVNRLLKQFDDMQRMMKKMKKGGPPPPPPPPPPPPPPPPPPP

3D structure

PDB

5nco Structure of the quaternary complex between SRP, SR, and translocon bound to the translating ribosome.

Chain

Resolution

4.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.4: signal-recognition-particle GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	i	E277 K278 A378 N381 S382 M383 T384 K386 S397 R398 R401 G405 C406	E274 K275 A375 N378 S379 M380 T381 K383 S394 R395 R398 G402 C403
BS02	rna	i	N94 A96 A97 Q98 K399 Q411 N414 K418 D422 R425 K428 K432 G433 G434 X435 X436 X446 X447 X448 X449 X450	N91 A93 A94 Q95 K396 Q408 N411 K415 D419 R422 K425 K429 G430 G431 X432 X433 X443 X444 X445 X446 X447
BS03	peptide	i	Q337 M341 X365 X367 M423	Q334 M338 X362 X364 M420
BS04	ALF	i	R141 A192 G193	R138 A189 G190
BS05	GDP	i	G110 G112 K113 T114 K119 R141 K249 D251 G274 G276 E277	G107 G109 K110 T111 K116 R138 K246 D248 G271 G273 E274
BS06	GDP	i	Q109 R141	Q106 R138

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0008312	7S RNA binding
GO:0016787	hydrolase activity
GO:0016887	ATP hydrolysis activity

	Biological Process
GO:0006612	protein targeting to membrane
GO:0006614	SRP-dependent cotranslational protein targeting to membrane

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0048500	signal recognition particle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5nco, PDBe:5nco, PDBj:5nco
PDBsum	5nco
PubMed	28524878
UniProt	P0AGD7\|SRP54_ECOLI Signal recognition particle protein (Gene Name=ffh)

[Back to BioLiP]