Structure of PDB 5mu8 Chain i

Receptor sequence

>5mu8i (length=145) Species: 9606 (Homo sapiens)

SDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLI
YSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPAK
PWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

3D structure

• PDB: 5mu8 Structural Basis of Small-Molecule Aggregate Induced Inhibition of a Protein-Protein Interaction.
• Chain: i
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	JNI	i	L57 Y59 Y119 G121	L49 Y51 Y107 G109	BindingDB: IC50=1200nM

Gene Ontology

Molecular Function

• GO:0005164 tumor necrosis factor receptor binding

Biological Process

• GO:0006955 immune response

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:5mu8, PDBe:5mu8, PDBj:5mu8
• PDBsum: 5mu8
• PubMed: 28300404
• UniProt: P01375|TNFA_HUMAN Tumor necrosis factor (Gene Name=TNF)