Structure of PDB 5imq Chain i

Receptor sequence

>5imqi (length=136) Species: 300852 (Thermus thermophilus HB8)

RMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMV
RHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFE
VAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
• Chain: i
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	Y9 R10 Q13 G15 L17 K18 G19 D25 Y26 F29 W41 Q46 A49 R56 F69 Y74 T75 K76 K77 E80 R82 M83 G84 K85 G86 K87 R101 F104 H123 K124 K128	Y4 R5 Q8 G10 L12 K13 G14 D20 Y21 F24 W36 Q41 A44 R51 F64 Y69 T70 K71 K72 E75 R77 M78 G79 K80 G81 K82 R96 F99 H118 K119 K123
BS02	rna	i	A20 A140 Q141	A15 A135 Q136

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5imq, PDBe:5imq, PDBj:5imq
• PDBsum: 5imq
• PubMed: 27137929
• UniProt: P60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)