Structure of PDB 5gpn Chain i

Receptor sequence

>5gpni (length=90) Species: 9823 (Sus scrofa)

MPLVYMNIIMAFAIALAGLLMYRSHLMSSLLCLEGMMLSLFIMSTLIILN
THFTLANMMPIILLVFAACEAALGLSLLVMVSNTYGTDYV

3D structure

• PDB: 5gpn The architecture of the mammalian respirasome.
• Chain: i
• Resolution: 5.4 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	i	M1 M6	M1 M6

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0016651 oxidoreductase activity, acting on NAD(P)H

Biological Process

• GO:0042773 ATP synthesis coupled electron transport
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:5gpn, PDBe:5gpn, PDBj:5gpn
• PDBsum: 5gpn
• PubMed: 27654917
• UniProt: P56632|NU4LM_PIG NADH-ubiquinone oxidoreductase chain 4L (Gene Name=MT-ND4L)