Structure of PDB 5gmk Chain i |
>5gmki (length=75) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVE IPVNSKGTPLGKILLKGDNITLITS |
|
PDB | 5gmk Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution |
Chain | i |
Resolution | 3.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
i |
F32 E33 F49 N86 |
F23 E24 F40 N69 |
|
|
|
|