Structure of PDB 5gah Chain i

Receptor sequence

>5gahi (length=126) Species: 562 (Escherichia coli)

GFDLNDFLEQLRQMKNMGGPPPPPPPPPPPPPPPPPPPPPPDDKVLVRME
AIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDDMQRMM
KKMKKGGPPPPPPPPPPPPPPPPPPP

3D structure

• PDB: 5gah Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
• Chain: i
• Resolution: 3.8 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.4: signal-recognition-particle GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	A378 N381 S382 M383 T384 M385 K386 R388 S397 R398 R401 G405 C406	A51 N54 S55 M56 T57 M58 K59 R61 S70 R71 R74 G78 C79
BS02	rna	i	K395 Q411 N414 K418 D421 D422 R425 K429 X435 X448 X449 X450 X451 X452 X453	K68 Q84 N87 K91 D94 D95 R98 K102 X108 X121 X122 X123 X124 X125 X126
BS03	peptide	i	Q337 M341 X350 X365 X366 Q419 M423 X439	Q10 M14 X23 X38 X39 Q92 M96 X112

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0008312 7S RNA binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity

Biological Process

• GO:0006612 protein targeting to membrane
• GO:0006614 SRP-dependent cotranslational protein targeting to membrane

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0048500 signal recognition particle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5gah, PDBe:5gah, PDBj:5gah
• PDBsum: 5gah
• PubMed: 26804923
• UniProt: P0AGD7|SRP54_ECOLI Signal recognition particle protein (Gene Name=ffh)