Structure of PDB 5gag Chain i

Receptor sequence

>5gagi (length=126) Species: 562 (Escherichia coli)

GFDLNDFLEQLRQMKNMGGPPPPPPPPPPPPPPPPPPPPPPDDKVLVRME
AIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDDMQRMM
KKMKKGGPPPPPPPPPPPPPPPPPPP

3D structure

• PDB: 5gag Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
• Chain: i
• Resolution: 3.8 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.4: signal-recognition-particle GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	V374 A378 N381 S382 M383 T384 M385 E387 S397 R398 R401 G405 C406	V47 A51 N54 S55 M56 T57 M58 E60 S70 R71 R74 G78 C79
BS02	rna	i	K395 Q411 N414 D421 D422 R425 K429 X448 X449 X450 X451 X452 X453	K68 Q84 N87 D94 D95 R98 K102 X121 X122 X123 X124 X125 X126
BS03	peptide	i	Q337 M341 X350 X354 X365 X366 D369 Q419 M423 M430 X435	Q10 M14 X23 X27 X38 X39 D42 Q92 M96 M103 X108

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0008312 7S RNA binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity

Biological Process

• GO:0006612 protein targeting to membrane
• GO:0006614 SRP-dependent cotranslational protein targeting to membrane

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0048500 signal recognition particle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5gag, PDBe:5gag, PDBj:5gag
• PDBsum: 5gag
• PubMed: 26804923
• UniProt: P0AGD7|SRP54_ECOLI Signal recognition particle protein (Gene Name=ffh)