Structure of PDB 5apn Chain i

Receptor sequence

>5apni (length=99) Species: 559292 (Saccharomyces cerevisiae S288C)

TVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLS
PYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH

3D structure

• PDB: 5apn Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
• Chain: i
• Resolution: 3.91 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	G14 K15 K25 I26 S27 Y28 K30 G31 A33 S34 R36 R41 Y53 K67 R68 K71 R76 G78 F80 R82 K86	G13 K14 K24 I25 S26 Y27 K29 G30 A32 S33 R35 R40 Y52 K66 R67 K70 R75 G77 F79 R81 K85

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5apn, PDBe:5apn, PDBj:5apn
• PDBsum: 5apn
• PubMed: 26709046
• UniProt: P05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)