Structure of PDB 5aj3 Chain i

Receptor sequence
>5aj3i (length=99) Species: 9823 (Sus scrofa) [Search protein sequence]
LSEYAVRMSRLSARLFGEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYP
NHNTYFALMGTLRFLGLYRDEHQDFRDEQLRLKKLRGKGKPRKGEGKRA
3D structure
PDB5aj3 Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
Chaini
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i K29 K32 F59 A60 G63 T64 F67 H75 K87 R89 K93 P94 R95 K96 G97 K100 R101 K26 K29 F56 A57 G60 T61 F64 H72 K84 R86 K90 P91 R92 K93 G94 K97 R98
BS02 peptide i R10 R13 R17 R7 R10 R14
External links