Structure of PDB 4v8t Chain i

Receptor sequence
>4v8ti (length=99) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLS
PYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH
3D structure
PDB4v8t Cryo-Em Structures of Arx1 and Maturation Factors Rei1 and Jjj1 Bound to the 60S Ribosomal Subunit
Chaini
Resolution8.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i G14 K15 V17 K25 I26 S27 Y28 K29 K30 G31 A33 S34 N35 R36 T37 R41 Y53 K67 R68 R76 L77 G78 R82 K84 G13 K14 V16 K24 I25 S26 Y27 K28 K29 G30 A32 S33 N34 R35 T36 R40 Y52 K66 R67 R75 L76 G77 R81 K83
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8t, PDBe:4v8t, PDBj:4v8t
PDBsum4v8t
PubMed23142985
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]