Structure of PDB 4v4j Chain i

Receptor sequence
>4v4ji (length=138) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYER
VDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEI
PRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
3D structure
PDB4v4j Interactions and dynamics of the Shine Dalgarno helix in the 70S ribosome.
Chaini
Resolution3.83 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i M1 T3 D4 A7 D8 T11 R14 N15 S29 F31 G55 P57 P89 G90 R92 Y94 R102 S113 G130 G131 E132 M1 T3 D4 A7 D8 T11 R14 N15 S29 F31 G55 P57 P89 G90 R92 Y94 R102 S113 G130 G131 E132
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4j, PDBe:4v4j, PDBj:4v4j
PDBsum4v4j
PubMed17940016
UniProtP0DOY9|RS8_THET8 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]