Structure of PDB 4fby Chain i

Receptor sequence
>4fbyi (length=137) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNP
SLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADI
FPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
3D structure
PDB4fby Room temperature femtosecond X-ray diffraction of photosystem II microcrystals.
Chaini
Resolution6.56 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM i A62 C63 C66 H67 L78 L85 Y101 M102 Y108 H118 P119 A36 C37 C40 H41 L52 L59 Y75 M76 Y82 H92 P93
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
GO:0018063 cytochrome c-heme linkage
GO:0019684 photosynthesis, light reaction
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fby, PDBe:4fby, PDBj:4fby
PDBsum4fby
PubMed22665786
UniProtP0A386|CY550_THEVB Photosystem II extrinsic protein V (Gene Name=psbV)

[Back to BioLiP]