Structure of PDB 3jd5 Chain i

Receptor sequence
>3jd5i (length=98) Species: 9913 (Bos taurus) [Search protein sequence]
LSEYALRMSRLSARLFSEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYP
NHNTYFALMGILRSVGLYRDEHQDFKDEQLRLKKLRGKVKPRKGEGKR
3D structure
PDB3jd5 Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
Chaini
Resolution7.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i K29 K32 G63 I64 H75 F78 K86 R89 K91 K93 P94 R95 K96 E98 G99 K100 R101 K26 K29 G60 I61 H72 F75 K83 R86 K88 K90 P91 R92 K93 E95 G96 K97 R98
BS02 peptide i R10 R17 R24 R7 R14 R21
Gene Ontology
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Cellular Component
External links
PDB RCSB:3jd5, PDBe:3jd5, PDBj:3jd5
PDBsum3jd5
PubMed24799711
UniProtP82926|RT33_BOVIN Small ribosomal subunit protein mS33 (Gene Name=MRPS33)

[Back to BioLiP]