Structure of PDB 3j79 Chain i

Receptor sequence

>3j79i (length=95) Species: 36329 (Plasmodium falciparum 3D7)

VNVPKTRKTYCSNKCKKHTMHKVSQYKKGKERLSSLGRRRYDMKQKGFGG
QTKPVFKKKAKTTKKIVLKLECTKCKKKRFQTMKRCKTFEMGADK

3D structure

• PDB: 3j79 Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
• Chain: i
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	V2 N3 P5 R8 K9 T10 Y11 S13 K17 K18 H19 Y27 K29 E32 R33 S35 S36 L37 G38 R40 R41 M44 K45 K47 G48 F49 G50 G51 Q52 K54 P55 V56 F57 K59 K60 A61 K62 T64 K66 K70 K78 K79 R80 F81 Q82 T83 K85 R86 K88 K96	V1 N2 P4 R7 K8 T9 Y10 S12 K16 K17 H18 Y26 K28 E31 R32 S34 S35 L36 G37 R39 R40 M43 K44 K46 G47 F48 G49 G50 Q51 K53 P54 V55 F56 K58 K59 A60 K61 T63 K65 K69 K77 K78 R79 F80 Q81 T82 K84 R85 K87 K95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j79, PDBe:3j79, PDBj:3j79
• PDBsum: 3j79
• PubMed: 24913268
• UniProt: O97231|RL44_PLAF7 Large ribosomal subunit protein eL42 (Gene Name=RPL44)