Structure of PDB 7y7a Chain hm

Receptor sequence
>7y7ahm (length=65) Species: 35688 (Porphyridium purpureum) [Search protein sequence]
ALRTRLGEILRPLNSEYGKVAPGWGTTPIMGVFMLLFFLFLLIILQIYNS
SLIIENVDVDWTSLG
3D structure
PDB7y7a In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.
Chainhm
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA hm F41 I44 F40 I43
BS02 CLA hm F38 F41 I45 Y49 F37 F40 I44 Y48
BS03 CLA hm T27 M31 F34 M35 F39 T26 M30 F33 M34 F38
BS04 CLA hm L11 N15 L10 N14
BS05 CLA hm F39 L40 F38 L39
BS06 CLA hm T5 G8 T4 G7
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y7a, PDBe:7y7a, PDBj:7y7a
PDBsum7y7a
PubMed36922595
UniProtW0RYU5

[Back to BioLiP]