Structure of PDB 6t59 Chain h3

Receptor sequence

>6t59h3 (length=122) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA

3D structure

PDB

6t59 TTC5 mediates autoregulation of tubulin via mRNA degradation.

Chain

Resolution

3.11 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h3	R70 K74 Y78 K79 R84 R93 L95 N96 K97 H98 K105 K106 R109 K110 R112	R69 K73 Y77 K78 R83 R92 L94 N95 K96 H97 K104 K105 R108 K109 R111
BS02	rna	h3	A6 R7 R10 S45 R48 R51 K52 A55 R56 L58 T59 N62 Q63 K66 L81 R84 T88 R89 R92	A5 R6 R9 S44 R47 R50 K51 A54 R55 L57 T58 N61 Q62 K65 L80 R83 T87 R88 R91

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6t59, PDBe:6t59, PDBj:6t59
PDBsum	6t59
PubMed	31727855
UniProt	G1SIT5\|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)