Structure of PDB 6hcj Chain h3

Receptor sequence
>6hcjh3 (length=122) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA
3D structure
PDB6hcj ZNF598 Is a Quality Control Sensor of Collided Ribosomes.
Chainh3
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h3 R70 Y78 K79 K87 R89 R93 R94 N96 K97 H98 S101 K106 R109 R112 R69 Y77 K78 K86 R88 R92 R93 N95 K96 H97 S100 K105 R108 R111
BS02 rna h3 K5 R7 R10 S45 K52 A55 R56 L58 Q63 K66 R84 R89 R92 R93 K4 R6 R9 S44 K51 A54 R55 L57 Q62 K65 R83 R88 R91 R92
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hcj, PDBe:6hcj, PDBj:6hcj
PDBsum6hcj
PubMed30293783
UniProtG1SIT5|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)

[Back to BioLiP]