Structure of PDB 7r81 Chain h2

Receptor sequence
>7r81h2 (length=310) Species: 5141 (Neurospora crassa) [Search protein sequence]
EQLILKGTLEGHNGWVTSLATSLENPNMLLSGSRDKSLIIWNLTRDETSY
GYPKRRLHGHSHIVSDCVISSDGAYALSASWDKTLRLWELSTGTTTRRFV
GHTNDVLSVSFSADNRQIVSGSRDRTIKLWNTLGDCKFTITEKGHTEWVS
CVRFSPNPQNPVIVSSGWDKLVKVWELSSCKLQTDHIGHTGYINAVTISP
DGSLCASGGKDGTTMLWDLNESKHLYSLNANDEIHALVFSPNRYWLCAAT
SSSIIIFDLEKKSKVDELKPEFQNIGKKSREPECVSLAWSADGQTLFAGY
TDNIIRAWGV
3D structure
PDB7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
Chainh2
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h2 H60 G61 H64 R100 G278 K280 S281 H58 G59 H62 R98 G276 K278 S279
Gene Ontology
Molecular Function
GO:0001965 G-protein alpha-subunit binding
GO:0005080 protein kinase C binding
GO:0005092 GDP-dissociation inhibitor activity
GO:0030546 signaling receptor activator activity
GO:0043022 ribosome binding
GO:0045182 translation regulator activity
Biological Process
GO:0006521 regulation of cellular amino acid metabolic process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0010508 positive regulation of autophagy
GO:0010629 negative regulation of gene expression
GO:0017148 negative regulation of translation
GO:0031139 positive regulation of conjugation with cellular fusion
GO:0061157 mRNA destabilization
GO:0070651 nonfunctional rRNA decay
GO:0072344 rescue of stalled ribosome
GO:0140469 GCN2-mediated signaling
GO:1902660 negative regulation of glucose mediated signaling pathway
GO:1903138 negative regulation of cell integrity MAPK cascade
GO:1903753 negative regulation of p38MAPK cascade
GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process
GO:1990145 maintenance of translational fidelity
GO:2000765 regulation of cytoplasmic translation
GO:2001125 negative regulation of translational frameshifting
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum7r81
PubMed34815343
UniProtQ01369|GBLP_NEUCR Small ribosomal subunit protein RACK1 (Gene Name=cpc-2)

[Back to BioLiP]